Recombinant Human C9orf72 protein, His-tagged

• Cat.No.: C9orf72-2915H
• Product Overview: Recombinant Human C9orf72 protein(1-221 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: N-His
• Protein length: 1-221 aa
• Form: Liquid in sterile PBS, pH7.4, 10% Glycerol.
• Molecular Mass: The protein has a calculated MW of 29 kDa.
• AASequence: MGSSHHHHHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMSTLCPPPSPAVAKTEIALSGKSPLLAATFAYWDNILGPRVRHIWAPKTEQVLLSDGEITFLANHTLNGEILRNAESGAIDVKFFVLSEKGVIIVSLIFDGNWNGDRSTYGLSIILPQTELSFYLPLHRVCVDRLTHIIRKGRIWMHKERQENVQKIILEGTERMEDQGQSIIPMLTGEVIPVMELLSSMKSHSVPEEIDIADTVLNDDDIGDSCHEGFLL
• Endotoxin: <1.0EU per 1μg (determined by the LAL method).
• Purity: > 90 % as determined by SDS-PAGE.
• Storage: Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1.0 mg/ml.
• Reconstitution: Centrifuge the vial at 4°C before opening to recover the entire contents.