Recombinant Human C9orf72 protein, His-tagged
Cat.No. : | C9orf72-2915H |
Product Overview : | Recombinant Human C9orf72 protein(1-221 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | April 17, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-221 aa |
Tag : | N-His |
Form : | Liquid in sterile PBS, pH7.4, 10% Glycerol. |
Molecular Mass : | The protein has a calculated MW of 29 kDa. |
Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
Purity : | > 90 % as determined by SDS-PAGE. |
Storage : | Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1.0 mg/ml. |
Reconstitution : | Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | MGSSHHHHHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMSTLCPPPSPAVAKTEIALSGKSPLLAATFAYWDNILGPRVRHIWAPKTEQVLLSDGEITFLANHTLNGEILRNAESGAIDVKFFVLSEKGVIIVSLIFDGNWNGDRSTYGLSIILPQTELSFYLPLHRVCVDRLTHIIRKGRIWMHKERQENVQKIILEGTERMEDQGQSIIPMLTGEVIPVMELLSSMKSHSVPEEIDIADTVLNDDDIGDSCHEGFLL |
◆ Recombinant Proteins | ||
C9orf72-2722HF | Recombinant Full Length Human C9orf72 Protein, GST-tagged | +Inquiry |
C9orf72-2037H | Recombinant Human C9orf72 Protein, His-tagged | +Inquiry |
C9orf72-0211H | Recombinant Human C9orf72 Protein, GST-Tagged | +Inquiry |
ACTN3-9341H | Recombinant Human ACTN3 protein, GST-tagged | +Inquiry |
C9orf72-2915H | Recombinant Human C9orf72 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C9orf72 Products
Required fields are marked with *
My Review for All C9orf72 Products
Required fields are marked with *
0
Inquiry Basket