Recombinant Human C9orf43 Protein, GST-Tagged
| Cat.No. : | C9orf43-0202H |
| Product Overview : | Human C9orf43 full-length ORF (NP_689999.1, 1 a.a. - 461 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | C9orf43 (Chromosome 9 Open Reading Frame 43) is a Protein Coding gene. |
| Source : | Wheat Germ |
| Species : | Human |
| Tag : | GST |
| Molecular Mass : | 78.6 kDa |
| AA Sequence : | MDLPDESQWDETTCGLAVCQHPQCWATIRRIERGHPRILGSSCKTPLDAEDKLPVLTVVDILDSGFAAHHLPECTFTKAHSLLSQSSKFYSKFHGRPPKGLPDKSLINCTNRLPKFPVLNLNETQLPCPEDVRNMVVLWIPEETEIHVSQHGKKKRKNSAVKSKSFLGLSGNQSAGTRVGTPGMIVPPPTPVQLSEQFSSDFLPLWAQSEALPQDLLKELLPGGKQTMLCPEMKIKLAMMKKNLPLEKNRPDSVISSKMFLSIHRLTLERPALRYPERLKKLHNLKTEGYRKQQQRQQQQQQQQKKVKTPIKKQEAKKKAKSDPGIQSTSHKHPVTTVHDRLYGYRTLPGQNSDMKQQQQMEKGTTSKQDSTERPKMNYYDHADFHHSVKSPELYETEPTNKDISAPVDAVPEAQAARQKKISFNFSEIMASTGWNSELKLLRILQDTDDEDEEDQSSGAE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | C9orf43 chromosome 9 open reading frame 43 [ Homo sapiens ] |
| Official Symbol | C9orf43 |
| Synonyms | C9ORF43; chromosome 9 open reading frame 43; uncharacterized protein C9orf43; MGC17358; |
| Gene ID | 257169 |
| mRNA Refseq | NM_152786 |
| Protein Refseq | NP_689999 |
| UniProt ID | Q8TAL5 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C9orf43 Products
Required fields are marked with *
My Review for All C9orf43 Products
Required fields are marked with *
0
Inquiry Basket
