Recombinant Human C9orf40 Protein, GST-Tagged

Cat.No. : C9orf40-0200H
Product Overview : Human C9orf40 full-length ORF (BAA91449.1, 1 a.a. - 194 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : C9orf40 (Chromosome 9 Open Reading Frame 40) is a Protein Coding gene.
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 47.4 kDa
AA Sequence : MAKRRAAEPVTFHVPWKRLLLCDFAEQPPPPPLWIRPPGVAHAGQLLGVPEQHRKRKIDAGTMAEPSASPSKRRDSGDNSAPSGQEREDHGLETGDPPLPPPPVLPGPGEELPGARLPGDGGDDGAGRAGPPRGDWGVASCQHNEEFWQYNTFQYWRNPLPPIDLADIEDLSEDTLTEATLQGRNEGAEVDMES
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C9orf40 chromosome 9 open reading frame 40 [ Homo sapiens ]
Official Symbol C9orf40
Synonyms C9ORF40; chromosome 9 open reading frame 40; uncharacterized protein C9orf40; FLJ10110; FLJ25795;
Gene ID 55071
mRNA Refseq NM_017998
Protein Refseq NP_060468
UniProt ID Q8IXQ3

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All C9orf40 Products

Required fields are marked with *

My Review for All C9orf40 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon