Recombinant Human C9orf169 Protein, GST-tagged

Cat.No. : C9orf169-5297H
Product Overview : Human MGC59937 full-length ORF ( NP_945352.1, 1 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CYSRT1 (Cysteine Rich Tail 1) is a Protein Coding gene.
Molecular Mass : 41.7 kDa
AA Sequence : MDPQEMVVKNPYAHISIPRAHLRPDLGQQLEVASTCSSSSEMQPLPVGPCAPEPTHLLQPTEVPGPKGAKGNQGAAPIQNQQAWQQPGNPYSSSQRQAGLTYAGPPPVGRGDDIAHHCCCCPCCHCCHCPPFCRCHSCCCCVIS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C9orf169 chromosome 9 open reading frame 169 [ Homo sapiens ]
Official Symbol C9orf169
Synonyms C9orf169; chromosome 9 open reading frame 169
Gene ID 375791
mRNA Refseq NM_199001
Protein Refseq NP_945352
UniProt ID A8MQ03

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All C9orf169 Products

Required fields are marked with *

My Review for All C9orf169 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon