Recombinant Human C9orf16 Protein, GST-Tagged

Cat.No. : C9orf16-0190H
Product Overview : Human C9orf16 full-length ORF (BAG38107.1, 1 a.a. - 83 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : C9orf16 (Chromosome 9 Open Reading Frame 16) is a Protein Coding gene.
Molecular Mass : 35.53 kDa
AA Sequence : MSGPNGDLGMPVEAGAEGEEDGFGEAEYAAINSMLDQINSCLDHLEEKNDHLHARLQELLESNRQTRLEFQQQLGEAPSDASP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C9orf16 chromosome 9 open reading frame 16 [ Homo sapiens ]
Official Symbol C9orf16
Synonyms EST00098
Gene ID 79095
mRNA Refseq NM_024112
Protein Refseq NP_077017
UniProt ID Q9BUW7

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All C9orf16 Products

Required fields are marked with *

My Review for All C9orf16 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon