Recombinant Human C8orf76 Protein, GST-Tagged

• Cat.No.: C8orf76-0172H
• Product Overview: Human C8orf76 full-length ORF (NP_116236.1, 1 a.a. - 380 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: C8orf76 (Chromosome 8 Open Reading Frame 76) is a Protein Coding gene. An important paralog of this gene is ZHX1-C8orf76.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 69.7 kDa
• AA Sequence: MDSGCWLFGGEFEDSVFEERPERRSGPPASYCAKLCEPQWFYEETESSDDVEVLTLKKFKGDLAYRRQEYQKALQEYSSISEKLSSTNFAMKRDVQEGQARCLAHLGRHMEALEIAANLENKATNTDHLTTVLYLQLAICSSLQNLEKTIFCLQKLISLHPFNPWNWGKLAEAYLNLGPALSAALASSQKQHSFTSSDKTIKSFFPHSGKDCLLCFPETLPESSLFSVEANSSNSQKNEKALTNIQNCMAEKRETVLIETQLKACASFIRTRLLLQFTQPQQTSFALERNLRTQQEIEDKMKGFSFKEDTLLLIAEVMGEDIPEKIKDEVHPEVKCVGSVALTALVTVSSEEFEDKWFRKIKDHFCPFENQFHTEIQILA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C8orf76 chromosome 8 open reading frame 76 [ Homo sapiens ]
• Official Symbol: C8orf76
• Synonyms: C8ORF76; chromosome 8 open reading frame 76; uncharacterized protein C8orf76; FLJ14825; MGC9784
• Gene ID: 84933
• mRNA Refseq: NM_032847
• Protein Refseq: NP_116236
• UniProt ID: Q96K31