Recombinant Human C8orf37 Protein, GST-Tagged

Cat.No. : C8orf37-0161H
Product Overview : Human C8orf37 full-length ORF (NP_808880.1, 1 a.a. - 207 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a ubiquitously expressed protein of unknown function. It has high levels of mRNA expression in the brain, heart, and retina and the protein co-localizes with polyglutamylated tubulin at the base of the primary cilium in human retinal pigment epithelial cells. Mutations in this gene have been associated with autosomal recessive cone-rod dystrophy (arCRD) and retinitis pigmentosa (arRP). [provided by RefSeq, Mar 2012]
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 49.8 kDa
AA Sequence : MAEDLDELLDEVESKFCTPDLLRRGMVEQPKGCGGGTHSSDRNQAKAKETLRSTETFKKEDDLDSLINEILEEPNLDKKPSKLKSKSSGNTSVRASIEGLGKSCSPVYLGGSSIPCGIGTNISWRACDHLRCIACDFLVVSYDDYMWDKSCDYLFFRNNMPEFHKLKAKLIKKKGTRAYACQCSWRTIEEVTDLQTDHQLRWVCGKH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C8orf37 chromosome 8 open reading frame 37 [ Homo sapiens (human) ]
Official Symbol C8orf37
Synonyms C8orf37; chromosome 8 open reading frame 37; RP64; BBS21; CORD16; smalltalk; protein C8orf37; Chromosome 8 Open Reading Frame 37; Smalltalk; Protein C8orf37; CORD16; BBS21; RP64
Gene ID 157657
mRNA Refseq NM_177965
Protein Refseq NP_808880
MIM 614477
UniProt ID Q96NL8

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All C8orf37 Products

Required fields are marked with *

My Review for All C8orf37 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon