Recombinant Human C6orf226 Protein, GST-tagged
| Cat.No. : | C6orf226-4783H |
| Product Overview : | Human LOC441150 full-length ORF (NP_001008739.1, 1 a.a. - 101 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | C6orf226 (Chromosome 6 Open Reading Frame 226) is a Protein Coding gene. |
| Source : | Wheat Germ |
| Species : | Human |
| Tag : | GST |
| Molecular Mass : | 37.51 kDa |
| AA Sequence : | MERPRSPQCSAPASASASVTLAQLLQLVQQGQELPGLEKRHIAAIHGEPTASRLPRRPKPWEAAALAESLPPPTLRIGTAPAEPGLVEAATAPSSWHTVGP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | C6orf226 chromosome 6 open reading frame 226 [ Homo sapiens (human) ] |
| Official Symbol | C6orf226 |
| Synonyms | C6orf226; chromosome 6 open reading frame 226; uncharacterized protein C6orf226 |
| Gene ID | 441150 |
| mRNA Refseq | NM_001008739 |
| Protein Refseq | NP_001008739 |
| UniProt ID | Q5I0X4 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C6orf226 Products
Required fields are marked with *
My Review for All C6orf226 Products
Required fields are marked with *
0
Inquiry Basket
