Recombinant Human C6orf203 Protein, GST-Tagged

• Cat.No.: C6orf203-0116H
• Product Overview: Human C6orf203 full-length ORF (NP_057571.1, 1 a.a. - 240 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: C6orf203 (Chromosome 6 Open Reading Frame 203) is a Protein Coding gene.
• Molecular Mass: 54.3 kDa
• AA Sequence: MAMASVKLLAGVLRKPDAWIGLWGVLRGTPSSYKLCTSWNRYLYFSSTKLRAPNYKTLFYNIFSLRLPGLLLSPECIFPFSVRLKSNIRSTKSTKKSLQKVDEEDSDEESHHDEMSEQEEELEDDPTVVKNYKDLEKAVQSFRYDVVLKTGLDIGRNKVEDAFYKGELRLNEEKLWKKSRTVKVGDTLDLLIGEDKEAGTETVMRILLKKVFEEKTESEKYRVVLRRWKSLKLPKKRMSK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C6orf203 chromosome 6 open reading frame 203 [ Homo sapiens (human) ]
• Official Symbol: C6orf203
• Synonyms: C6orf203; chromosome 6 open reading frame 203; uncharacterized protein C6orf203; Chromosome 6 Open Reading Frame 203; Uncharacterized Protein C6orf203; HSPC230; PRED31
• Gene ID: 51250
• mRNA Refseq: NM_001142468
• Protein Refseq: NP_001135940
• UniProt ID: Q9P0P8