Recombinant Human C6orf203 Protein, GST-Tagged

Cat.No. : C6orf203-0116H
Product Overview : Human C6orf203 full-length ORF (NP_057571.1, 1 a.a. - 240 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : C6orf203 (Chromosome 6 Open Reading Frame 203) is a Protein Coding gene.
Molecular Mass : 54.3 kDa
AA Sequence : MAMASVKLLAGVLRKPDAWIGLWGVLRGTPSSYKLCTSWNRYLYFSSTKLRAPNYKTLFYNIFSLRLPGLLLSPECIFPFSVRLKSNIRSTKSTKKSLQKVDEEDSDEESHHDEMSEQEEELEDDPTVVKNYKDLEKAVQSFRYDVVLKTGLDIGRNKVEDAFYKGELRLNEEKLWKKSRTVKVGDTLDLLIGEDKEAGTETVMRILLKKVFEEKTESEKYRVVLRRWKSLKLPKKRMSK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C6orf203 chromosome 6 open reading frame 203 [ Homo sapiens (human) ]
Official Symbol C6orf203
Synonyms C6orf203; chromosome 6 open reading frame 203; uncharacterized protein C6orf203; Chromosome 6 Open Reading Frame 203; Uncharacterized Protein C6orf203; HSPC230; PRED31
Gene ID 51250
mRNA Refseq NM_001142468
Protein Refseq NP_001135940
UniProt ID Q9P0P8

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All C6orf203 Products

Required fields are marked with *

My Review for All C6orf203 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon