Recombinant Human C6orf106 Protein, GST-Tagged

• Cat.No.: C6orf106-0099H
• Product Overview: Human C6orf106 full-length ORF (NP_077270.1, 1 a.a. - 298 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: C6orf106 (Chromosome 6 Open Reading Frame 106) is a Protein Coding gene. GO annotations related to this gene include ubiquitin binding.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 59.3 kDa
• AA Sequence: MEGMDVDLDPELMQKFSCLGTTDKDVLISEFQRLLGFQLNPAGCAFFLDMTNWNLQAAIGAYYDFESPNISVPSMSFVEDVTIGEGESIPPDTQFVKTWRIQNSGAEAWPPGVCLKYVGGDQFGHVNMVMVRSLEPQEIADVSVQMCSPSRAGMYQGQWRMCTATGLYYGDVIWVILSVEVGGLLGVTQQLSSFETEFNTQPHRKVEGNFNPFASPQKNRQSDENNLKDPGGSEFDSISKNTWAPAPDTWAPAPDQTEQDQNRLSQNSVNLSPSSHANNLSVVTYSKGLHGPYPFGQS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C6orf106 chromosome 6 open reading frame 106 [ Homo sapiens ]
• Official Symbol: C6orf106
• Synonyms: FP852; dJ391O22.4; RP3-391O22.4
• Gene ID: 64771
• mRNA Refseq: NM_024294
• Protein Refseq: NP_077270
• MIM: 612217
• UniProt ID: Q9H6K1