Recombinant Human C5AR1 protein, GST-tagged

• Cat.No.: C5AR1-301544H
• Product Overview: Recombinant Human C5AR1 (1-70 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Met1-Ile70
• AA Sequence: MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVWVTAFEAKRTI
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: C5AR1 complement component 5a receptor 1 [ Homo sapiens ]
• Official Symbol: C5AR1
• Synonyms: C5AR1; complement component 5a receptor 1; C5R1, complement component 5 receptor 1 (C5a ligand); C5a anaphylatoxin chemotactic receptor; C5A; C5AR; CD88; C5a-R; C5a ligand; C5a anaphylatoxin receptor; complement component 5 receptor 1; C5R1
• Gene ID: 728
• mRNA Refseq: NM_001736
• Protein Refseq: NP_001727
• MIM: 113995
• UniProt ID: P21730