Active Recombinant Full Length Human C5AR1 Protein, C-Flag-tagged

• Cat.No.: C5AR1-348HFL
• Product Overview: Recombinant Full Length Human C5AR1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Description: Enables G protein-coupled receptor activity and complement component C5a receptor activity. Involved in several processes, including complement component C5a signaling pathway; mRNA transcription by RNA polymerase II; and positive regulation of ERK1 and ERK2 cascade. Located in apical part of cell and basolateral plasma membrane. Biomarker of Alzheimer's disease; asthma; chronic obstructive pulmonary disease; rhinitis; and severe acute respiratory syndrome.
• Source: Mammalian cells
• Species: Human
• Tag: Flag
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Bio-activity: Binding assay
• Molecular Mass: 39.1 kDa
• AA Sequence: MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVWVTAFEAKRTI NAIWFLNLAVADFLSCLALPILFTSIVQHHHWPFGGAACSILPSLILLNMYASILLLATISADRFLLVFK PIWCQNFRGAGLAWIACAVAWGLALLLTIPSFLYRVVREEYFPPKVLCGVDYSHDKRRERAVAIVRLVLG FLWPLLTLTICYTFILLRTWSRRATRSTKTLKVVVAVVASFFIFWLPYQVTGIMMSFLEPSSPTFLLLNK LDSLCVSFAYINCCINPIIYVVAGQGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome, GPCR, Transmembrane
• Protein Pathways: Complement and coagulation cascades, Neuroactive ligand-receptor interaction
• Full Length: Full L.

Gene Information

• Gene Name: C5AR1 complement C5a receptor 1 [ Homo sapiens (human) ]
• Official Symbol: C5AR1
• Synonyms: C5A; C5AR; C5R1; CD88
• Gene ID: 728
• mRNA Refseq: NM_001736.4
• Protein Refseq: NP_001727.2
• MIM: 113995
• UniProt ID: P21730