Recombinant Human C4orf46 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: C4orf46-2083H
• Product Overview: C4orf46 MS Standard C13 and N15-labeled recombinant protein (NP_001008394) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a small, conserved protein of unknown function that is expressed in a variety of tissues. There are pseudogenes for this gene on chromosomes 6, 8, 16, and X. Alternative splicing results in multiple transcript variants.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 11.9 kDa
• AA Sequence: MADPEELQVSSPPPPPPSSPSSSDASAASSPGGPVSLGWPVPSRSSGPTVDQLEEVELQIGDAAFSLTKLLEATSAVSAQVEELAFKCTENARFLKTWRDLLKEGYDSLKPDDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: C4orf46 chromosome 4 open reading frame 46 [ Homo sapiens (human) ]
• Official Symbol: C4orf46
• Synonyms: C4ORF46; chromosome 4 open reading frame 46; uncharacterized protein C4orf46; LOC201725
• Gene ID: 201725
• mRNA Refseq: NM_001008393
• Protein Refseq: NP_001008394
• MIM: 616210
• UniProt ID: Q504U0