Recombinant Human C4orf33 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: C4orf33-5476H
• Product Overview: C4orf33 MS Standard C13 and N15-labeled recombinant protein (NP_775758) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: C4orf33 (Chromosome 4 Open Reading Frame 33) is a Protein Coding gene.
• Molecular Mass: 23.4 kDa
• AA Sequence: MDFKIEHTWDGFPVKHEPVFIRLNPGDRGVMMDISAPFFRDPPAPLGEPGKPFNELWDYEVVEAFFLNDITEQYLEVELCPHGQHLVLLLSGRRNVWKQELPLSFRVSRGETKWEGKAYLPWSYFPPNVTKFNSFAIHGSKDKRSYEALYPVPQHELQQGQKPDFHCLEYFKSFNFNTLLGEEWKQPESDLWLIEKCDITRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: C4orf33 chromosome 4 open reading frame 33 [ Homo sapiens (human) ]
• Official Symbol: C4orf33
• Synonyms: C4ORF33; chromosome 4 open reading frame 33; UPF0462 protein C4orf33; FLJ33703
• Gene ID: 132321
• mRNA Refseq: NM_173487
• Protein Refseq: NP_775758
• UniProt ID: Q8N1A6