Recombinant Human C4orf26 Protein, GST-Tagged

• Cat.No.: C4orf26-0061H
• Product Overview: Human C4orf26 full-length ORF (BAD18758.1, 1 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Dental enamel forms the outer cap of teeth and is the hardest substance found in vertebrates. This gene is thought to encode an extracellular matrix acidic phosphoprotein that has a function in enamel mineralization during amelogenesis. Mutations in this gene are associated with recessive hypomineralized amelogenesis imperfecta. [provided by RefSeq, Oct 2012]
• Molecular Mass: 42 kDa
• AA Sequence: MARRHCFSYWLLVCWLVVTVAEGQEEVFTLPGDSQNNADATDCQIFTLTPPPAPRSPVTRAQPITKTPRCPFHFFPRRPRIHFRFPNRPFVPSRCNHRFPFQPFYWPHRYLTYRYFPRRRLQRGSSSEES
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C4orf26 chromosome 4 open reading frame 26 [ Homo sapiens (human) ]
• Official Symbol: C4orf26
• Synonyms: C4orf26; chromosome 4 open reading frame 26; AI2A4; uncharacterized protein C4orf26; amelogenesis imperfecta type IIA4; Chromosome 4 Open Reading Frame 26; Amelogenesis Imperfecta Type IIA4; Uncharacterized Protein C4orf26; AI2A4
• Gene ID: 152816
• mRNA Refseq: NM_001206981
• Protein Refseq: NP_001193910
• MIM: 614829
• UniProt ID: Q17RF5