Recombinant Human C4BPB

• Cat.No.: C4BPB-26312TH
• Product Overview: Recombinant full length Human C4 binding protein with N terminal proprietary tag; predicted MWt: 53.35 kDa including the tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 252 amino acids
• Description: This gene encodes a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. A single, unique beta-chain encoded by this gene assembles with seven identical alpha-chains into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. C4b-binding protein has a regulatory role in the coagulation system also, mediated through the beta-chain binding of protein S, a vitamin K-dependent protein that serves as a cofactor of activated protein C. The genes encoding both alpha and beta chains are located adjacent to each other on human chromosome 1 in the regulator of complement activation gene cluster. Alternative splicing gives rise to multiple transcript variants.
• Molecular Weight: 53.350kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MFFWCACCLMVAWRVSASDEHCPELPPVDNSIFVAKEV EGQILGTYVCIKGYHLVGKKTLFCNASKEWDNTTTECRLG HCPDPVLVNGEFSSSGPVNVSDKITFMCNDHYILKGSNRS QCLEDHTWAPPFPICKSRDCDPPGNPVHGYFEGNNFTLGS TISYYCEDRYYLVGVQEQQCVDGEWSSALPVCKLIQEAPK PECEKALLAFQESKNLCEAMENFMQQLKESGMTMEELKYS LELKKAELKAKLL
• Sequence Similarities: Contains 3 Sushi (CCP/SCR) domains.

Gene Information

• Gene Name: C4BPB complement component 4 binding protein, beta [ Homo sapiens ]
• Official Symbol: C4BPB
• Synonyms: C4BPB; complement component 4 binding protein, beta; C4BP, complement component 4 binding protein, beta; C4b-binding protein beta chain; C4b binding protein; beta chain; complement component 4 binding protein
• Gene ID: 725
• mRNA Refseq: NM_000716
• Protein Refseq: NP_000707
• MIM: 120831
• Uniprot ID: P20851
• Chromosome Location: 1q32
• Pathway: Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem; FOXA1 transcription factor network, organism-specific biosystem; Pertussis, organism-specific biosystem; Pertussis, conserved biosystem