Recombinant Human C4A protein, T7/His-tagged

• Cat.No.: C4A-188H
• Product Overview: Recombinant human C4 gamma domain cDNA ( 1454 – 1744 aa ) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His&T7
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFEAPKVVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRA DLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPS KSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQ VLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQR AACAQLNDFLQEYGTQGCQV
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro human complement C4d mediated cancer cell resistant to complement-mediated damage pathway regulation study by using this protein as coating matrix protein or soluble factor.2. May be used for protein-protein interaction assay.3. Potential Diagnostic biomarker protein for tumors, such as lung cancer.4. As antigen for specific antibody production.
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
• Protein length: 1454-1744 a.a.

Gene Information

• Gene Name: C4A complement component 4A (Rodgers blood group) [ Homo sapiens ]
• Official Symbol: C4A
• Synonyms: C4A; complement component 4A (Rodgers blood group); complement component 4A; complement C4-A; C4; C4A2; C4A3; C4A4; C4A6; C4B; C4S; CO4; CPAMD2; RG; acidic C4; C4A anaphylatoxin; Rodgers form of C4; acidic complement C4; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 2; C4AD; MGC164979
• Gene ID: 720
• mRNA Refseq: NM_001252204
• Protein Refseq: NP_001239133
• MIM: 120810
• UniProt ID: P0C0L4
• Chromosome Location: 6p21.3
• Pathway: Activation of C3 and C5, organism-specific biosystem; Complement Activation, Classical Pathway, organism-specific biosystem; Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem; Complement cascade, organism-specific biosystem; Immune System, organism-specific biosystem; Initial triggering of complement, organism-specific biosystem
• Function: endopeptidase inhibitor activity