Recombinant Human C3orf56 Protein, GST-Tagged

• Cat.No.: C3orf56-0040H
• Product Overview: Human C3orf56 full-length ORF (NP_001007535.1, 1 a.a. - 242 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: C3orf56 (Chromosome 3 Open Reading Frame 56) is a Protein Coding gene.
• Molecular Mass: 52.4 kDa
• AA Sequence: MGTGASEKQAEQKVRRAFEASEEAHGTLAASTPWVAMGSAYGSCTCLGAQPVTDLALWPVIYSCMGFSPQAYPAFWAYPWVLYGGYLWMGYPPPAALVPSVWLYWRGASSFDPLIGSPYLAALAPNLFPFPMKFPPTYSLASPTLGGATSSHCPQVGCWTPASSAPRAAVEGPSRGAPYLKTCKAPPSEWASRFGIWAPLPCCSSELRPLPPSPIEDSQLDPGCSRSSSRSPCRARRRLFEC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C3orf56 chromosome 3 open reading frame 56 [ Homo sapiens (human) ]
• Official Symbol: C3orf56
• Synonyms: C3orf56; chromosome 3 open reading frame 56; putative uncharacterized protein C3orf56; Chromosome 3 Open Reading Frame 56
• Gene ID: 285311
• mRNA Refseq: NM_001007534
• Protein Refseq: NP_001007535
• UniProt ID: Q8N813