Recombinant Human C2orf69 protein, His&Myc-tagged

• Cat.No.: C2orf69-165H
• Product Overview: Recombinant Human C2orf69 protein(Q8N8R5)(25-385aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cells.

Specification

• Species: Human
• Source: Insect Cells
• Tag: His&Myc
• Protein Length: 25-385aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 44.7kDa
• AA Sequence: SSCSQARTMNPGGSGGARCSLSAEVRRRQCLQLSTVPGADPQRSNELLLLAAAGEGLERQDLPGDPAKEEPQPPPQHHVLYFPGDVQNYHEIMTRHPENYQWENWSLENVATILAHRFPNSYIWVIKCSRMHLHKFSCYDNFVKSNMFGAPEHNTDFGAFKHLYMLLVNAFNLSQNSLSKKSLNVWNKDSIASNCRSSPSHTTNGCQGEKVRTCEKSDESAMSFYPPSLNDASFTLIGFSKGCVVLNQLLFELKEAKKDKNIDAFIKSIRTMYWLDGGHSGGSNTWVTYPEVLKEFAQTGIIVHTHVTPYQVRDPMRSWIGKEHKKFVQILGDLGMQVTSQIHFTKEAPSIENHFRVHEVF
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: C2orf69 chromosome 2 open reading frame 69 [ Homo sapiens ]
• Official Symbol: C2orf69
• Synonyms: C2ORF69; chromosome 2 open reading frame 69; UPF0565 protein C2orf69; FLJ38973; hypothetical protein FLJ38973
• Gene ID: 205327
• mRNA Refseq: NM_153689
• Protein Refseq: NP_710156
• UniProt ID: Q8N8R5