Recombinant Human C2orf62 Protein, GST-tagged

• Cat.No.: C2orf62-5294H
• Product Overview: Human MGC50811 full-length ORF ( AAH52750, 1 a.a. - 387 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: CATIP (Ciliogenesis Associated TTC17 Interacting Protein) is a Protein Coding gene. GO annotations related to this gene include calmodulin binding.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 68.31 kDa
• AA Sequence: MSSKVYSTGSRAKDHQPSGPECLPLPEANAEAIDFLSSLHKEELQMLFFSETLAMVSDTGEPQGELTIEVQRGKYQEKLGMLTYCLFVHASSRGFLDKMLCGNSLLGYLSEKLELMEQHSQDFIKFLILPMERKMSLLKQDDQLAVTRSIKEGEEVKTGVTSFPWSSIKGFISEAANLVLLRVMAWRRMVPSNARFLTLDTEGKLCYLTYQNLGFQTIQVDHQQAEVFIVEQTVHAEEGIPMSCQYYLLSDGHLAKRIQVGSPGCCIITKMPILREEDEIEPRPVFEKKPLVWEEDMELYSKFLDRKEELRLGHASYLRQHPEAHALISDFLLFLLLRQPEDVVTFAAEFFGPFDPWRPSSPALGSSHRPNPFRSLEPEGDARSGAA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C2orf62 chromosome 2 open reading frame 62 [ Homo sapiens ]
• Official Symbol: C2orf62
• Synonyms: C2ORF62; chromosome 2 open reading frame 62; uncharacterized protein C2orf62; MGC50811
• Gene ID: 375307
• mRNA Refseq: NM_198559
• Protein Refseq: NP_940961
• UniProt ID: Q7Z7H3