Recombinant Human C2orf27A Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: C2orf27A-2930H
• Product Overview: C2orf27A MS Standard C13 and N15-labeled recombinant protein (NP_037442) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: C2orf27A (Chromosome 2 Open Reading Frame 27A) is an RNA Gene, and is affiliated with the lncRNA class. Diseases associated with C2orf27A include Common Wart and Ebola Hemorrhagic Fever. An important paralog of this gene is C2orf27B.
• Molecular Mass: 21.3 kDa
• AA Sequence: MTVKWKQLSAPASGAEIQRFPVPAVEPVPAPGADSPPGTALELEEAPEPSCRCPGTAQDQPSEELPDFMAPPVEPPASALELKVWLELEVAERGGQHSSSQQLPHCSQSWAQWKLWRQRPGFAIWAPLPHWRGTSLIQQSSSPAAEGPAATAAGAVCLPAGGAGEQEKEPVSRGSSRSSCSQRRPPPPGMEVCPQLGIWAICPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: C2orf27A chromosome 2 open reading frame 27A [ Homo sapiens (human) ]
• Official Symbol: C2orf27A
• Synonyms: C2orf27A; chromosome 2 open reading frame 27A; C2orf27; C2orf27B; uncharacterized protein C2orf27; uncharacterized protein C2orf27A; MGC138394; DKFZp686A02119
• Gene ID: 29798
• mRNA Refseq: NM_013310
• Protein Refseq: NP_037442
• UniProt ID: P0DPF5