Recombinant Human C1QC Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: C1QC-5655H
• Product Overview: C1QC MS Standard C13 and N15-labeled recombinant protein (NP_758957) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes the C-chain polypeptide of serum complement subcomponent C1q, which associates with C1r and C1s to yield the first component of the serum complement system. C1q is composed of 18 polypeptide chains which include 6 A-chains, 6 B-chains, and 6 C-chains. Each chain contains an N-terminal collagen-like region and a C-terminal C1q globular domain. C1q deficiency is associated with lupus erythematosus and glomerulonephritis.
• Molecular Mass: 25.8 kDa
• AA Sequence: MDVGPSSLPHLGLKLLLLLLLLPLRGQANTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEPGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPDSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: C1QC complement C1q C chain [ Homo sapiens (human) ]
• Official Symbol: C1QC
• Synonyms: C1QC; complement component 1, q subcomponent, C chain; C1QG, complement component 1, q subcomponent, gamma polypeptide; complement C1q subcomponent subunit C; complement component 1, q subcomponent, gamma polypeptide; C1QG; C1Q-C; FLJ27103
• Gene ID: 714
• mRNA Refseq: NM_172369
• Protein Refseq: NP_758957
• MIM: 120575
• UniProt ID: P02747