Recombinant Human C1QC protein, His-GST-tagged

• Cat.No.: C1QC-143H
• Product Overview: Recombinant Human ADAM10 protein(Q13428)(Gln1251-Lys1480), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: C-His
• Protein length: Gln1251-Lys1480
• Form: Phosphate buffered saline
• Molecular Mass: 27 kDa
• AASequence: QAAGMLSPKTGGKEAASGTTPQKSRKPKKGAGNPQASTLALQSNITQCLLGQPWPLNEAQVQASVVKVLTELLEQERKKVVDTTKESSRKGWESRKRKLSGDQPAARTPRSKKKKKLGAGEGGEASVSPEKTSTTSKGKAKRDKASGDVKEKKGKGSLGSQGAKDEPEEELQKGMGTVEGGDQSNPKSKKEKKKSDKRKKDKEKKEKKKKAKKASTKDSESPSQKKKKKK
• Storage: Store at -20°C to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: ADAM10 ADAM metallopeptidase domain 10 [ Homo sapiens ]
• Official Symbol: ADAM10
• Synonyms: ADAM10; ADAM metallopeptidase domain 10; a disintegrin and metalloproteinase domain 10; disintegrin and metalloproteinase domain-containing protein 10; CD156c; HsT18717; kuz; MADM; CDw156; ADAM 10; kuzbanian protein homolog; mammalian disintegrin-metalloprotease; a disintegrin and metalloprotease domain 10; AD10
• Gene ID: 102
• mRNA Refseq: NM_001110
• Protein Refseq: NP_001101
• MIM: 602192
• UniProt ID: O14672