Recombinant Human C1QC protein, His-GST-tagged

Cat.No. : C1QC-143H
Product Overview : Recombinant Human ADAM10 protein(Q13428)(Gln1251-Lys1480), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Gln1251-Lys1480
Tag : C-His
Form : Phosphate buffered saline
Molecular Mass : 27 kDa
Storage : Store at -20°C to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : QAAGMLSPKTGGKEAASGTTPQKSRKPKKGAGNPQASTLALQSNITQCLLGQPWPLNEAQVQASVVKVLTELLEQERKKVVDTTKESSRKGWESRKRKLSGDQPAARTPRSKKKKKLGAGEGGEASVSPEKTSTTSKGKAKRDKASGDVKEKKGKGSLGSQGAKDEPEEELQKGMGTVEGGDQSNPKSKKEKKKSDKRKKDKEKKEKKKKAKKASTKDSESPSQKKKKKK
Gene Name ADAM10 ADAM metallopeptidase domain 10 [ Homo sapiens ]
Official Symbol ADAM10
Synonyms ADAM10; ADAM metallopeptidase domain 10; a disintegrin and metalloproteinase domain 10; disintegrin and metalloproteinase domain-containing protein 10; CD156c; HsT18717; kuz; MADM; CDw156; ADAM 10; kuzbanian protein homolog; mammalian disintegrin-metalloprotease; a disintegrin and metalloprotease domain 10; AD10;
Gene ID 102
mRNA Refseq NM_001110
Protein Refseq NP_001101
MIM 602192
UniProt ID O14672

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All C1QC Products

Required fields are marked with *

My Review for All C1QC Products

Required fields are marked with *

0

Inquiry Basket

cartIcon