Recombinant Human C1orf50 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : C1orf50-4375H
Product Overview : C1orf50 MS Standard C13 and N15-labeled recombinant protein (NP_077002) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : C1orf50 (Chromosome 1 Open Reading Frame 50) is a Protein Coding gene.
Molecular Mass : 21.9 kDa
AA Sequence : MEDAAAPGRTEGVLERQGAPPAAGQGGALVELTPTPGGLALVSPYHTHRAGDPLDLVALAEQVQKADEFIRANATNKLTVIAEQIQHLQEQARKVLEDAHRDANLHHVACNIVKKPGNIYYLYKRESGQQYFSIISPKEWGTSCPHDFLGAYKLQHDLSWTPYEDIEKQDAKISMMDMLLSQSVALPPCTEPNFQGLTHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name C1orf50 chromosome 1 open reading frame 50 [ Homo sapiens (human) ]
Official Symbol C1orf50
Synonyms C1ORF50; chromosome 1 open reading frame 50; uncharacterized protein C1orf50; MGC955;
Gene ID 79078
mRNA Refseq NM_024097
Protein Refseq NP_077002
UniProt ID Q9BV19

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All C1orf50 Products

Required fields are marked with *

My Review for All C1orf50 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon