Recombinant Human C1orf50 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: C1orf50-4375H
• Product Overview: C1orf50 MS Standard C13 and N15-labeled recombinant protein (NP_077002) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: C1orf50 (Chromosome 1 Open Reading Frame 50) is a Protein Coding gene.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 21.9 kDa
• AA Sequence: MEDAAAPGRTEGVLERQGAPPAAGQGGALVELTPTPGGLALVSPYHTHRAGDPLDLVALAEQVQKADEFIRANATNKLTVIAEQIQHLQEQARKVLEDAHRDANLHHVACNIVKKPGNIYYLYKRESGQQYFSIISPKEWGTSCPHDFLGAYKLQHDLSWTPYEDIEKQDAKISMMDMLLSQSVALPPCTEPNFQGLTHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: C1orf50 chromosome 1 open reading frame 50 [ Homo sapiens (human) ]
• Official Symbol: C1orf50
• Synonyms: C1ORF50; chromosome 1 open reading frame 50; uncharacterized protein C1orf50; MGC955
• Gene ID: 79078
• mRNA Refseq: NM_024097
• Protein Refseq: NP_077002
• UniProt ID: Q9BV19