Recombinant Human C19orf24 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | C19orf24-2586H |
Product Overview : | C19orf24 MS Standard C13 and N15-labeled recombinant protein (NP_060384) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Description : | FAM174C (Family With Sequence Similarity 174 Member C) is a Protein Coding gene. |
Source : | HEK293 |
Species : | Human |
Tag : | Myc&DDK |
Molecular Mass : | 14.1 kDa |
AA Sequence : | MREGQEMGPTPVPSNPLLHRSFPCWPRGWSHPVPTRELLLEPAQPADLLPPAPTAGPCSLASWMLSQPGRGSQVKTGGTPTATAQDAEAPLPDCDLCLSPAPVGTWQPRAKAGWAGDPRNLSGNTFSPGWEQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | C19orf24 chromosome 19 open reading frame 24 [ Homo sapiens (human) ] |
Official Symbol | C19orf24 |
Synonyms | C19ORF24; chromosome 19 open reading frame 24; uncharacterized membrane protein C19orf24; FLJ20640; |
Gene ID | 55009 |
mRNA Refseq | NM_017914 |
Protein Refseq | NP_060384 |
UniProt ID | Q9BVV8 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All C19orf24 Products
Required fields are marked with *
My Review for All C19orf24 Products
Required fields are marked with *
0
Inquiry Basket