Recombinant Human C18orf32 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: C18orf32-1311H
• Product Overview: C18orf32 MS Standard C13 and N15-labeled recombinant protein (NP_001030177) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: C18orf32 (Chromosome 18 Open Reading Frame 32) is a Protein Coding gene. Diseases associated with C18orf32 include Agnathia-Otocephaly Complex. Gene Ontology (GO) annotations related to this gene include obsolete signal transducer activity and structural constituent of ribosome.
• Molecular Mass: 8.7 kDa
• AA Sequence: MVCIPCIVIPVLLWIYKKFLEPYIYPLVSPFVSRIWPKKAIQESNDTNKGKVNFKGADMNGLPTKGPTEICDKKKDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: C18orf32 chromosome 18 open reading frame 32 [ Homo sapiens (human) ]
• Official Symbol: C18orf32
• Synonyms: C18orf32; chromosome 18 open reading frame 32; UPF0729 protein C18orf32; putative NF-kappa-B-activating protein 200; putative NFkB activating protein
• Gene ID: 497661
• mRNA Refseq: NM_001035005
• Protein Refseq: NP_001030177
• UniProt ID: Q8TCD1