Recombinant Human C17orf99 protein, His&Myc-tagged

• Cat.No.: C17orf99-92H
• Product Overview: Recombinant Human C17orf99 protein(Q6UX52)(182-265aa), fused with N-terminal His tag and C-terminal Myc tag was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His&Myc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 16.8 kDa
• Protein length: 182-265aa
• AA Sequence: FSFLPSQTSDWFWCQAANNANVQHSALTVVPPGGDQKMEDWQGPLESPILALPLYRSTRRLSEEEFGGFRIGNGEVRGRKAAAM
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: C17orf99 chromosome 17 open reading frame 99 [ Homo sapiens ]
• Official Symbol: C17orf99
• Synonyms: UNQ464
• Gene ID: 100141515
• mRNA Refseq: NM_001163075.1
• Protein Refseq: NP_001156547.1
• UniProt ID: Q6UX52