Recombinant Human C14orf159 protein, His-tagged

• Cat.No.: C14orf159-3769H
• Product Overview: Recombinant Human C14orf159 protein(1-85 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 1-85 aa
• AA Sequence: MPFTLHLRSRLPSAIRSLILQKKPNIRNTSSMAGELRPASLVVLPRSLAPAFERFCQVNTGPLPLLGQSEPEKWMLPPQGAISET
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: C14orf159 chromosome 14 open reading frame 159 [ Homo sapiens ]
• Official Symbol: C14orf159
• Synonyms: C14ORF159; chromosome 14 open reading frame 159; UPF0317 protein C14orf159, mitochondrial; FLJ39975; FLJ20950; FLJ39943; DKFZp686I02128
• Gene ID: 80017
• mRNA Refseq: NM_001102366
• Protein Refseq: NP_001095836
• UniProt ID: Q7Z3D6