Recombinant Human C12orf57 Protein, GST-tagged

• Cat.No.: C12orf57-5318H
• Product Overview: Human GRCC10 full-length ORF ( AAH09925, 1 a.a. - 126 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is ubiquitously expressed in human tissues. It is required for development of the human corpus callosum. Mutations in this gene are associated with Temtamy syndrome (TEMTYS). Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Sep 2014]
• Molecular Mass: 39.6 kDa
• AA Sequence: MASASTQPAALSAEQAKVVLAEVIQAFSAPENAVRMDEARDNACNDMGKMLQFVLPVATQIQQEVIKAYGFSCDGEGVLKFARLVKSYEAQDPEIASLSGKLKALFLPPMTLPPHGPAAGGSVAAS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C12orf57 chromosome 12 open reading frame 57 [ Homo sapiens (human) ]
• Official Symbol: C12orf57
• Synonyms: C12orf57; chromosome 12 open reading frame 57; C10; GRCC10; protein C10; gene rich cluster C10; likely ortholog of mouse gene rich cluster, C10
• Gene ID: 113246
• mRNA Refseq: NM_001301834
• Protein Refseq: NP_001288763
• MIM: 615140
• UniProt ID: Q99622