Recombinant Human C12orf49 Protein, GST-tagged

Cat.No. : C12orf49-507H
Product Overview : Human C12orf49 full-length ORF (BAB15058.1, 1 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 50 kDa
AA Sequence : MVNLAAMVWRRLLRKRWVLALVFGLSLVYFLSSTFKQEERAVRDRNLLQVHDHNQPIPWKVQFNLGNSSRPSNQCRNSIQGKHLITDELGYVCERKDLLVNGCCNVNVPSTKQYCCDGCWPNGCCSAYEYCVSCCLQPNKQLLLERFLNRAAVAFQNLFMAVEDHFELCLAKCRTSSQSVQHENTYRDPIAKYCYGESPPELFPA
Endotoxin : <0.1 ng/ug (<1 EU/ug)
Storage : Store at -20 centigrade.Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex. For extended storage, to further dilute in buffer containing carrier protein (e.g. 0.1% BSA) and store in aliquots at -20°C to -80°C is recommended.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C12orf49 chromosome 12 open reading frame 49 [ Homo sapiens ]
Official Symbol C12orf49
Synonyms C12ORF49; chromosome 12 open reading frame 49; UPF0454 protein C12orf49; FLJ21415;
Gene ID 79794
mRNA Refseq NM_024738
Protein Refseq NP_079014
UniProt ID Q9H741

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All C12orf49 Products

Required fields are marked with *

My Review for All C12orf49 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon