Recombinant Human C12orf39 Protein, GST-tagged

• Cat.No.: C12orf39-500H
• Product Overview: Human C12orf39 full-length ORF (BAG51298.1, 1 a.a. - 116 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 39.7 kDa
• AA Sequence: MKGLRSLAATTLALFLVFVFLGNSSCAPQRLLERRNWTPQAMLYLKGAQGRRFISDQSRRKDLSDRPLPERRSPNPQLLTIPEAATILLASLQKSPEDEEKNFDQTRFLEDSLLNW
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C12orf39 chromosome 12 open reading frame 39 [ Homo sapiens ]
• Official Symbol: C12orf39
• Synonyms: C12orf39
• Gene ID: 80763
• mRNA Refseq: NM_030572.2
• Protein Refseq: NP_085049.1
• UniProt ID: Q9BT56