Recombinant Human C11orf74 Protein, GST-tagged

Cat.No. : C11orf74-485H
Product Overview : Human C11orf74 full-length ORF ( NP_620142.2, 1 a.a. - 221 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 51.8 kDa
AA Sequence : MSAHMSGLEIMDEDQLIKDVLDKFLNCHEQTYDEEFLNTFTHLSQEDHVSKRGVFGTDSSENIFTSAKVTHKNEADDYHLRNKTIFLRTSSQCLEEQVDNFLDLEDLDMDEEIKPQMSEDLLLLPGEVEQDVSTSIPSCIPFVAQPPTCEVKPKPSVKRMDKQTEEILGDEVQLFSLDEEFDYDNVMLTSKFSPAEIENIKELCKQQKRKDTSPDLEKSCD
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C11orf74 chromosome 11 open reading frame 74 [ Homo sapiens ]
Official Symbol C11orf74
Synonyms C11ORF74; chromosome 11 open reading frame 74; uncharacterized protein C11orf74; FLJ38678; HEPIS;
Gene ID 119710
mRNA Refseq NM_138787
Protein Refseq NP_620142
UniProt ID Q86VG3

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All C11orf74 Products

Required fields are marked with *

My Review for All C11orf74 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon