Recombinant Human C11orf67 Protein, GST-tagged

• Cat.No.: C11orf67-480H
• Product Overview: Human C11orf67 full-length ORF (BAB14963.1, 1 a.a. - 122 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 39.7 kDa
• AA Sequence: MTSPEIASLSWGQMKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEKGVQTLVIGRGMSEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHSTC
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C11orf67 chromosome 11 open reading frame 67 [ Homo sapiens ]
• Official Symbol: C11orf67
• Synonyms: C11ORF67; chromosome 11 open reading frame 67; UPF0366 protein C11orf67; CK067; FLJ21035; PTD015; MGC3367
• Gene ID: 28971
• mRNA Refseq: NM_024684
• Protein Refseq: NP_078960
• UniProt ID: Q9H7C9