Recombinant Human C11orf46 Protein, GST-tagged

Cat.No. : C11orf46-468H
Product Overview : Human C11orf46 full-length ORF ( NP_689529.1, 1 a.a. - 260 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 55.7 kDa
AA Sequence : MMDPCSVGVQLRTTNECHKTYYTRHTGFKTLQELSSNDMLLLQLRTGMTLSGNNTICFHHVKIYIDRFEDLQKSCCDPFNIHKKLAKKNLHVIDLDDATFLSAKFGRQLVPGWKLCPKCTQIINGSVDVDTEDRQKRKPESDGRTAKALRSLQFTNPGRQTEFAPETGKREKRRLTKNATAGSDRQVIPAKSKVYDSQGLLIFSGMDLCDCLDEDCLGCFYACPACGSTKCGAECRCDRKWLYEQIEIEGGEIIHNKHAG
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C11orf46 chromosome 11 open reading frame 46 [ Homo sapiens ]
Official Symbol C11orf46
Synonyms C11ORF46; chromosome 11 open reading frame 46; ARF7 effector protein; FLJ38968; uncharacterized protein C11orf46; ARF7EP; dJ299F11.1;
Gene ID 120534
mRNA Refseq NM_152316
Protein Refseq NP_689529
MIM 612295
UniProt ID Q8N8R7

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All C11orf46 Products

Required fields are marked with *

My Review for All C11orf46 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon