Recombinant Human C11orf30 Protein, GST-tagged
| Cat.No. : | C11orf30-465H |
| Product Overview : | Human C11orf30 partial ORF ( NP_064578, 1081 a.a. - 1178 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Source : | Wheat Germ |
| Species : | Human |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 36.52 kDa |
| AA Sequence : | PASSEKQTASQVEQPIITQGSSVTKITFEGRQPPTVTKITGGSSVPKLTSPVTSISPIQASEKTAVSDILKMSLMEAQIDTNVEHMIVDPPKKALATS |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | C11orf30 chromosome 11 open reading frame 30 [ Homo sapiens ] |
| Official Symbol | C11orf30 |
| Synonyms | C11ORF30; chromosome 11 open reading frame 30; protein EMSY; EMSY; GL002; FLJ90741; |
| Gene ID | 56946 |
| mRNA Refseq | NM_020193 |
| Protein Refseq | NP_064578 |
| MIM | 608574 |
| UniProt ID | Q7Z589 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C11orf30 Products
Required fields are marked with *
My Review for All C11orf30 Products
Required fields are marked with *
0
Inquiry Basket
