Recombinant Human C10orf35 Protein, GST-tagged

Cat.No. : C10orf35-427H
Product Overview : Human C10orf35 full-length ORF (AAH13587.1, 1 a.a. - 121 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 39.71 kDa
AA Sequence : MVRILANGEIVQDDDPRVRTTTQPPRGSIPRQSFFNRGHGAPPGGPGPRQQQAGARLGAAQSPFNDLNRQLVNMGFPQWHLGNHAVEPVTSILLLFLLMMLGVRGLLLVGLVYLVSHLSQR
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C10orf35 chromosome 10 open reading frame 35 [ Homo sapiens ]
Official Symbol C10orf35
Synonyms C10orf25
Gene ID 219738
mRNA Refseq NM_145306.2
Protein Refseq NP_660349.1
UniProt ID Q96D05

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All C10orf35 Products

Required fields are marked with *

My Review for All C10orf35 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon