Recombinant Human C10orf129 Protein, GST-tagged
| Cat.No. : | C10orf129-420H |
| Product Overview : | Human C10orf129 full-length ORF (BAC86458.1, 1 a.a. - 186 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Source : | Wheat Germ |
| Species : | Human |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 47.1 kDa |
| AA Sequence : | MSKAQCIVANEAMAPVVNSAVSDCPTLKTKLLVSDKSYDGWLDFKKLIQVAPPKQTYMRTKSQDPMAIFFTKGTTGAPKMVEYSQYGLGMGFSQASRRWMDLQPTDVLWSLGDAFGGSLSLSAVLGTWFQGACVFLCHMPTFCPETVLNVLSRFPITTLSANPEMYQELLQHKCFTRVYSVPLPKQ |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | C10orf129 chromosome 10 open reading frame 129 [ Homo sapiens ] |
| Official Symbol | C10orf129 |
| Synonyms | C10ORF129; chromosome 10 open reading frame 129; acyl-coenzyme A synthetase ACSM6, mitochondrial; bA310E22.3; AMP-binding enzyme; ACSM6; |
| Gene ID | 142827 |
| mRNA Refseq | NM_207321 |
| Protein Refseq | NP_997204 |
| UniProt ID | Q6P461 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C10orf129 Products
Required fields are marked with *
My Review for All C10orf129 Products
Required fields are marked with *
0
Inquiry Basket
