Recombinant Human C10orf116 Protein, GST-tagged
| Cat.No. : | C10orf116-415H |
| Product Overview : | Human C10orf116 full-length ORF (BAG34968.1, 1 a.a. - 76 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | APM2 gene is exclusively expressed in adipose tissue. Its function is currently unknown. |
| Source : | Wheat Germ |
| Species : | Human |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 34.76 kDa |
| AA Sequence : | MASKGLQDLKQQVEGTAQEAVSAAGAAAQQVVDQATEAGQKAMDQLAKTTQETIDKTANQASDTFSGIGKKFGLLK |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | C10orf116 chromosome 10 open reading frame 116 [ Homo sapiens ] |
| Official Symbol | C10orf116 |
| Synonyms | C10ORF116; chromosome 10 open reading frame 116; adipose most abundant gene transcript 2 protein; adipose specific 2; APM2; apM-2; RP11-96C23.4; |
| Gene ID | 10974 |
| mRNA Refseq | NM_006829 |
| Protein Refseq | NP_006820 |
| UniProt ID | Q15847 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C10orf116 Products
Required fields are marked with *
My Review for All C10orf116 Products
Required fields are marked with *
0
Inquiry Basket
