Recombinant Human C10orf116 Protein, GST-tagged
Cat.No. : | C10orf116-415H |
Product Overview : | Human C10orf116 full-length ORF (BAG34968.1, 1 a.a. - 76 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | APM2 gene is exclusively expressed in adipose tissue. Its function is currently unknown. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 34.76 kDa |
AA Sequence : | MASKGLQDLKQQVEGTAQEAVSAAGAAAQQVVDQATEAGQKAMDQLAKTTQETIDKTANQASDTFSGIGKKFGLLK |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C10orf116 chromosome 10 open reading frame 116 [ Homo sapiens ] |
Official Symbol | C10orf116 |
Synonyms | C10ORF116; chromosome 10 open reading frame 116; adipose most abundant gene transcript 2 protein; adipose specific 2; APM2; apM-2; RP11-96C23.4; |
Gene ID | 10974 |
mRNA Refseq | NM_006829 |
Protein Refseq | NP_006820 |
UniProt ID | Q15847 |
◆ Recombinant Proteins | ||
C10orf116-415H | Recombinant Human C10orf116 Protein, GST-tagged | +Inquiry |
C10orf116-10346H | Recombinant Human C10orf116, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C10orf116-8374HCL | Recombinant Human C10orf116 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C10orf116 Products
Required fields are marked with *
My Review for All C10orf116 Products
Required fields are marked with *
0
Inquiry Basket