Recombinant Human C10orf111 Protein

• Cat.No.: C10orf111-414H
• Product Overview: Human C10orf111 full-length ORF (ADZ15789.1) recombinant protein without tag.

Specification

• Source: Wheat Germ
• Species: Human
• Form: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
• Molecular Mass: 17.1 kDa
• AA Sequence: MESLQTPQHRENQDKREKEYGVKHMPMGNNAGNLEPEKRKAVRVALSSATAAQNIPSSVHCGCSKQWRLRLPSESLQSRGQVMKRPNNILKLRNLDLLIYPWPELRRRQVASDLMSLLLLPAFSGLTWAPFLFLFTYLPPFLNLLTVGFVSYFLV
• Usage: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
• Tag: Non

Gene Information

• Gene Name: C10orf111 chromosome 10 open reading frame 111 [ Homo sapiens ]
• Official Symbol: C10orf111
• Synonyms: bA455B2.4
• Gene ID: 221060
• mRNA Refseq: NM_153244.1
• Protein Refseq: NP_694976.1
• UniProt ID: Q8N326