Recombinant Human C10orf107 Protein, GST-tagged
| Cat.No. : | C10orf107-413H |
| Product Overview : | Human C10orf107 full-length ORF ( NP_775825.1, 1 a.a. - 208 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Source : | Wheat Germ |
| Species : | Human |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 50.3 kDa |
| AA Sequence : | MDFSIIQYSKFMTLLAMSLQNLKTLHMSLEESIKWLGEVMAEIGPTHSQKSEDWNIFDVKQANAIIDYLKISLFQHYKLYEFMFYSAREEIVIGTEQVIEVVKSACGPFPNPLEEGISFDIYSTFIEPPTILDTEMKRLDQEQGPEESQPETDTSDMDPLVGFTIEDVKSVLDQVTDDILIGIQTEINEKLQIQEEAFNARIEKLKKA |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | C10orf107 chromosome 10 open reading frame 107 [ Homo sapiens ] |
| Official Symbol | C10orf107 |
| Synonyms | bA63A2.1 |
| Gene ID | 219621 |
| mRNA Refseq | NM_173554.2 |
| Protein Refseq | NP_775825.1 |
| UniProt ID | Q8IVU9 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C10orf107 Products
Required fields are marked with *
My Review for All C10orf107 Products
Required fields are marked with *
0
Inquiry Basket
