Recombinant Human C10orf107 Protein, GST-tagged
Cat.No. : | C10orf107-413H |
Product Overview : | Human C10orf107 full-length ORF ( NP_775825.1, 1 a.a. - 208 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 50.3 kDa |
AA Sequence : | MDFSIIQYSKFMTLLAMSLQNLKTLHMSLEESIKWLGEVMAEIGPTHSQKSEDWNIFDVKQANAIIDYLKISLFQHYKLYEFMFYSAREEIVIGTEQVIEVVKSACGPFPNPLEEGISFDIYSTFIEPPTILDTEMKRLDQEQGPEESQPETDTSDMDPLVGFTIEDVKSVLDQVTDDILIGIQTEINEKLQIQEEAFNARIEKLKKA |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C10orf107 chromosome 10 open reading frame 107 [ Homo sapiens ] |
Official Symbol | C10orf107 |
Synonyms | bA63A2.1 |
Gene ID | 219621 |
mRNA Refseq | NM_173554.2 |
Protein Refseq | NP_775825.1 |
UniProt ID | Q8IVU9 |
◆ Recombinant Proteins | ||
C10orf107-1290H | Recombinant Human C10orf107 Protein, GST/His-tagged | +Inquiry |
C10orf107-413H | Recombinant Human C10orf107 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C10orf107-8376HCL | Recombinant Human C10orf107 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C10orf107 Products
Required fields are marked with *
My Review for All C10orf107 Products
Required fields are marked with *
0
Inquiry Basket