Recombinant Human C10orf10 Protein, GST-tagged

• Cat.No.: C10orf10-412H
• Product Overview: Human C10orf10 full-length ORF ( NP_008952.1, 1 a.a. - 212 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The expression of this gene is induced by fasting as well as by progesterone. The protein encoded by this gene contains a t-synaptosome-associated protein receptor (SNARE) coiled-coil homology domain and a peroxisomal targeting signal. Production of the encoded protein leads to phosphorylation and activation of the transcription factor ELK1.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 49.8 kDa
• AA Sequence: MRSRLLLSVAHLPTIRETTEEMLLGGPGQEPPPSPSLDDYVRSISRLAQPTSVLDKATAQGQPRPPHRPAQACRKGRPAVSLRDITARFSGQQPTLPMADTVDPLDWLFGESQEKQPSQRDLPRRTGPSAGLWGPHRQMDSSKPMGAPRGRLCEARMPGHSLARPPQDGQQSSDLRSWTFGQSAQAMASRHRPRPSSVLRTLYSHLPVIHEL
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C10orf10 chromosome 10 open reading frame 10 [ Homo sapiens (human) ]
• Official Symbol: C10orf10
• Synonyms: FIG; DEPP; Fseg
• Gene ID: 11067
• mRNA Refseq: NM_007021.2
• Protein Refseq: NP_008952.1
• MIM: 611309
• UniProt ID: Q9NTK1