Recombinant Human BUD31 Protein, GST-tagged

• Cat.No.: BUD31-4604H
• Product Overview: Human G10 full-length ORF ( AAH22821, 1 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: BUD31 (BUD31 Homolog) is a Protein Coding gene. Among its related pathways are mRNA Splicing - Major Pathway and Gene Expression. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 41.47 kDa
• AA Sequence: MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BUD31 BUD31 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: BUD31
• Synonyms: BUD31; BUD31 homolog (S. cerevisiae); BUD31 homolog (yeast); protein BUD31 homolog; EDG 2; EDG2; fSAP17; functional spliceosome associated protein 17; G10; G10 maternal transcript homolog (Xenopus laevis); YCR063W; protein EDG-2; protein G10 homolog; maternal G10 transcript; G10 maternal transcript homolog; functional spliceosome-associated protein 17; EDG-2; MGC111202
• Gene ID: 8896
• mRNA Refseq: NM_003910
• Protein Refseq: NP_003901
• MIM: 603477
• UniProt ID: P41223