Recombinant Human BUD31 Protein, GST-tagged
Cat.No. : | BUD31-4604H |
Product Overview : | Human G10 full-length ORF ( AAH22821, 1 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | BUD31 (BUD31 Homolog) is a Protein Coding gene. Among its related pathways are mRNA Splicing - Major Pathway and Gene Expression. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding. |
Molecular Mass : | 41.47 kDa |
AA Sequence : | MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BUD31 BUD31 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | BUD31 |
Synonyms | BUD31; BUD31 homolog (S. cerevisiae); BUD31 homolog (yeast); protein BUD31 homolog; EDG 2; EDG2; fSAP17; functional spliceosome associated protein 17; G10; G10 maternal transcript homolog (Xenopus laevis); YCR063W; protein EDG-2; protein G10 homolog; maternal G10 transcript; G10 maternal transcript homolog; functional spliceosome-associated protein 17; EDG-2; MGC111202; |
Gene ID | 8896 |
mRNA Refseq | NM_003910 |
Protein Refseq | NP_003901 |
MIM | 603477 |
UniProt ID | P41223 |
◆ Recombinant Proteins | ||
BUD31-1147Z | Recombinant Zebrafish BUD31 | +Inquiry |
BUD31-692R | Recombinant Rat BUD31 Protein, His (Fc)-Avi-tagged | +Inquiry |
BUD31-1121M | Recombinant Mouse BUD31 Protein, His (Fc)-Avi-tagged | +Inquiry |
BUD31-5097HF | Recombinant Full Length Human BUD31 Protein, GST-tagged | +Inquiry |
BUD31-3325H | Recombinant Human BUD31 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BUD31-8380HCL | Recombinant Human BUD31 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BUD31 Products
Required fields are marked with *
My Review for All BUD31 Products
Required fields are marked with *
0
Inquiry Basket