Recombinant Full Length Human BUD31 Protein, GST-tagged

Cat.No. : BUD31-5097HF
Product Overview : Human G10 full-length ORF ( AAH22821, 1 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 144 amino acids
Description : BUD31 (BUD31 Homolog) is a Protein Coding gene. Among its related pathways are mRNA Splicing - Major Pathway and Gene Expression. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding.
Molecular Mass : 41.47 kDa
AA Sequence : MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BUD31 BUD31 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol BUD31
Synonyms BUD31; BUD31 homolog (S. cerevisiae); BUD31 homolog (yeast); protein BUD31 homolog; EDG 2; EDG2; fSAP17; functional spliceosome associated protein 17; G10; G10 maternal transcript homolog (Xenopus laevis); YCR063W; protein EDG-2; protein G10 homolog; maternal G10 transcript; G10 maternal transcript homolog; functional spliceosome-associated protein 17; EDG-2; MGC111202;
Gene ID 8896
mRNA Refseq NM_003910
Protein Refseq NP_003901
MIM 603477
UniProt ID P41223

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BUD31 Products

Required fields are marked with *

My Review for All BUD31 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon