Recombinant Human BUB1 protein, His-tagged

• Cat.No.: BUB1-2948H
• Product Overview: Recombinant Human BUB1 protein(785-1083 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 785-1083 aa
• AA Sequence: KLVYVHHLLGEGAFAQVYEATQGDLNDAKNKQKFVLKVQKPANPWEFYIGTQLMERLKPSMQHMFMKFYSAHLFQNGSVLVGELYSYGTLLNAINLYKNTPEKVMPQGLVISFAMRMLYMIEQVHDCEIIHGDIKPDNFILGNGFLEQDDEDDLSAGLALIDLGQSIDMKLFPKGTIFTAKCETSGFQCVEMLSNKPWNYQIDYFGVAATVYCMLFGTYMKVKNEGGECKPEGLFRRLPHLDMWNEFFHVMLNIPDCHHLPSLDLLRQKLKKVFQQHYTNKIRALRNRLIVLLLECKRS
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) [ Homo sapiens ]
• Official Symbol: BUB1
• Synonyms: BUB1; budding uninhibited; BUB1L, budding uninhibited by benzimidazoles 1 (yeast homolog); mitotic checkpoint serine/threonine-protein kinase BUB1; BUB1A; hBUB1; mitotic spindle checkpoint kinase; putative serine/threonine-protein kinase; BUB1 budding uninhibited by benzimidazoles 1 homolog; BUB1L
• Gene ID: 699
• mRNA Refseq: NM_004336
• Protein Refseq: NP_004327
• MIM: 602452
• UniProt ID: O43683