Recombinant Human BTRC protein, GST-tagged
Cat.No. : | BTRC-12H |
Product Overview : | Recombinant Human BTRC protein(308-605 aa), fused with GST tag, was expressed in E. coli, |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 308-605 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | CLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAQAEPPRSPSRTYTYISR |
Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
Gene Name | BTRC beta-transducin repeat containing E3 ubiquitin protein ligase [ Homo sapiens ] |
Official Symbol | BTRC |
Synonyms | BTRC; beta-transducin repeat containing E3 ubiquitin protein ligase; beta transducin repeat containing; F-box/WD repeat-containing protein 1A; beta TrCP1; betaTrCP; bTrCP; bTrCP1; FBXW1A; Fwd1; beta-TrCP1; E3RSIkappaB; F-box and WD-repeat protein 1B; pIkappaBalpha-E3 receptor subunit; F-box and WD repeats protein beta-TrCP; FWD1; FBW1A; FBXW1; BETA-TRCP; MGC4643 |
Gene ID | 8945 |
mRNA Refseq | NM_001256856 |
Protein Refseq | NP_001243785 |
MIM | 603482 |
UniProt ID | Q9Y297 |
◆ Recombinant Proteins | ||
BTRC-1687HF | Recombinant Full Length Human BTRC Protein, GST-tagged | +Inquiry |
BTRC-99C | Recombinant Cynomolgus Monkey BTRC Protein, His (Fc)-Avi-tagged | +Inquiry |
BTRC-2545M | Recombinant Mouse BTRC Protein | +Inquiry |
BTRC-11H | Recombinant Human BTRC protein, His-tagged | +Inquiry |
BTRC-1118M | Recombinant Mouse BTRC Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTRC-8384HCL | Recombinant Human BTRC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BTRC Products
Required fields are marked with *
My Review for All BTRC Products
Required fields are marked with *
0
Inquiry Basket