Recombinant Human BTNL9 protein, His-tagged

• Cat.No.: BTNL9-49H
• Product Overview: Recombinant Human Butyrophilin-like Protein 9 is produced by our Mammalian expression system and the target gene encoding Glu48-Ser160 is expressed with a 6His tag at the C-terminus.

Specification

• Source: HEK293
• Species: Human
• Tag: His
• Form: Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
• Protein length: Glu48-Ser160
• AA Sequence: EVKVLGPEYPILALVGEEVEFPCHLWPQLDAQQMEIRWFRSQTFNVVHLYQEQQELPGRQMPAFR NRTKLVKDDIAYGSVVLQLHSIIPSDKGTYGCRFHSDNFSGEALWELEVAGLGSDPHLSHHHHHH
• Endotoxin: Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Purity: Greater than 90% as determined by reducing SDS-PAGE.
• Storage: Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
  Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
  Aliquots of reconstituted samples are stable at < -20°C for 3 months.
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
  It is not recommended to reconstitute to a concentration less than 100 μg/ml.
  Dissolve the lyophilized protein in ddH2O.
  Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Shipping: The product is shipped at ambient temperature.

Gene Information

• Gene Name: BTNL9 butyrophilin-like 9 [ Homo sapiens ]
• Official Symbol: BTNL9
• Synonyms: BTNL9; butyrophilin-like 9; butyrophilin-like protein 9; FLJ32535; butyrophilin 3; BTN3; VDLS1900
• Gene ID: 153579
• mRNA Refseq: NM_152547
• Protein Refseq: NP_689760
• UniProt ID: Q6UXG8