Recombinant Human BTNL9 protein, His-tagged
Cat.No. : | BTNL9-49H |
Product Overview : | Recombinant Human Butyrophilin-like Protein 9 is produced by our Mammalian expression system and the target gene encoding Glu48-Ser160 is expressed with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | Glu48-Ser160 |
Form : | Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4. |
AA Sequence : | EVKVLGPEYPILALVGEEVEFPCHLWPQLDAQQMEIRWFRSQTFNVVHLYQEQQELPGRQMPAFR NRTKLVKDDIAYGSVVLQLHSIIPSDKGTYGCRFHSDNFSGEALWELEVAGLGSDPHLSHHHHHH |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Purity : | Greater than 90% as determined by reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Shipping : | The product is shipped at ambient temperature. |
Gene Name | BTNL9 butyrophilin-like 9 [ Homo sapiens ] |
Official Symbol | BTNL9 |
Synonyms | BTNL9; butyrophilin-like 9; butyrophilin-like protein 9; FLJ32535; butyrophilin 3; BTN3; VDLS1900; |
Gene ID | 153579 |
mRNA Refseq | NM_152547 |
Protein Refseq | NP_689760 |
UniProt ID | Q6UXG8 |
◆ Recombinant Proteins | ||
BTNL9-002M | Recombinant Human BTNL9(Asp36-Lys257) Protein, C-Fc-tagged | +Inquiry |
BTNL9-49H | Recombinant Human BTNL9 protein, His-tagged | +Inquiry |
BTNL9-48H | Recombinant Human BTNL9, His-tagged | +Inquiry |
BTNL9-50H | Recombinant Human BTNL9(Ser35–Lys256) Protein, C-Fc-tagged | +Inquiry |
BTNL9-2544M | Recombinant Mouse BTNL9 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BTNL9 Products
Required fields are marked with *
My Review for All BTNL9 Products
Required fields are marked with *
0
Inquiry Basket