Recombinant Human BTN3A3 protein, His-SUMO-tagged
Cat.No. : | BTN3A3-2605H |
Product Overview : | Recombinant Human BTN3A3 protein(O00478)(30-248aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 30-248aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 39.6 kDa |
AA Sequence : | QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELRWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHIEVKGYEDGGIHLECRSTGWYPQPQIKWSDTKGENIPAVEAPVVADGVGLYAVAASVIMRGSSGGGVSCIIRNSLLGLEKTASISIADPFFRSAQPW |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | BTN3A3 butyrophilin, subfamily 3, member A3 [ Homo sapiens ] |
Official Symbol | BTN3A3 |
Synonyms | BTN3A3; butyrophilin, subfamily 3, member A3; butyrophilin subfamily 3 member A3; BTF3; butyrophilin 3; |
Gene ID | 10384 |
mRNA Refseq | NM_001242803 |
Protein Refseq | NP_001229732 |
MIM | 613595 |
UniProt ID | O00478 |
◆ Recombinant Proteins | ||
BTN3A3-617H | Recombinant Human BTN3A3 Protein | +Inquiry |
BTN3A3-365H | Recombinant Human BTN3A3 Protein (30-248 aa), His-SUMO-tagged | +Inquiry |
BTN3A3-2812H | Recombinant Human BTN3A3 Protein, MYC/DDK-tagged | +Inquiry |
BTN3A3-0797H | Recombinant Human BTN3A3 Protein (Gln30-Trp248), C-His tagged | +Inquiry |
BTN3A3-1344H | Recombinant Human BTN3A3 Protein (30-248 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTN3A3-754HCL | Recombinant Human BTN3A3 cell lysate | +Inquiry |
BTN3A3-789HCL | Recombinant Human BTN3A3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BTN3A3 Products
Required fields are marked with *
My Review for All BTN3A3 Products
Required fields are marked with *
0
Inquiry Basket