Recombinant Human BTN3A3 Protein (30-248 aa), His-tagged

• Cat.No.: BTN3A3-1344H
• Product Overview: Recombinant Human BTN3A3 Protein (30-248 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Partial.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• ProteinLength: 30-248 aa
• Description: Plays a role in T-cell responses in the adaptive immune response.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 25.6 kDa
• AA Sequence: QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELRWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHIEVKGYEDGGIHLECRSTGWYPQPQIKWSDTKGENIPAVEAPVVADGVGLYAVAASVIMRGSSGGGVSCIIRNSLLGLEKTASISIADPFFRSAQPW
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: BTN3A3 butyrophilin, subfamily 3, member A3 [ Homo sapiens ]
• Official Symbol: BTN3A3
• Synonyms: BTN3A3; BTF3; butyrophilin 3
• Gene ID: 10384
• mRNA Refseq: NM_001242803
• Protein Refseq: NP_001229732
• MIM: 613595
• UniProt ID: O00478