Recombinant Human BTN3A3 Protein (30-248 aa), His-SUMO-tagged
Cat.No. : | BTN3A3-365H |
Product Overview : | Recombinant Human BTN3A3 Protein (30-248 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 30-248 aa |
Description : | Plays a role in T-cell responses in the adaptive immune response. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 39.6 kDa |
AA Sequence : | QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELRWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHIEVKGYEDGGIHLECRSTGWYPQPQIKWSDTKGENIPAVEAPVVADGVGLYAVAASVIMRGSSGGGVSCIIRNSLLGLEKTASISIADPFFRSAQPW |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | BTN3A3 butyrophilin, subfamily 3, member A3 [ Homo sapiens ] |
Official Symbol | BTN3A3 |
Synonyms | BTN3A3; BTF3; butyrophilin 3; |
Gene ID | 10384 |
mRNA Refseq | NM_001242803 |
Protein Refseq | NP_001229732 |
MIM | 613595 |
UniProt ID | O00478 |
◆ Recombinant Proteins | ||
BTN3A3-234H | Recombinant Human BTN3A3, Fc-tagged | +Inquiry |
BTN3A3-0238H | Recombinant Human BTN3A3 protein, His-tagged | +Inquiry |
BTN3A3-365H | Recombinant Human BTN3A3 Protein (30-248 aa), His-SUMO-tagged | +Inquiry |
BTN3A3-0797H | Recombinant Human BTN3A3 Protein (Gln30-Trp248), C-His tagged | +Inquiry |
BTN3A3-1678HF | Recombinant Full Length Human BTN3A3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTN3A3-754HCL | Recombinant Human BTN3A3 cell lysate | +Inquiry |
BTN3A3-789HCL | Recombinant Human BTN3A3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BTN3A3 Products
Required fields are marked with *
My Review for All BTN3A3 Products
Required fields are marked with *
0
Inquiry Basket