Recombinant Human BTN3A2 Protein (30-248 aa), His-SUMO-tagged

Cat.No. : BTN3A2-364H
Product Overview : Recombinant Human BTN3A2 Protein (30-248 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Immunology. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 30-248 aa
Description : Plays a role in T-cell responses in the adaptive immune response. Inhibits the release of IFNG from activated T-cells.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 39.6 kDa
AA Sequence : QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPW
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name BTN3A2 butyrophilin, subfamily 3, member A2 [ Homo sapiens ]
Official Symbol BTN3A2
Synonyms BTN3A2; BTF4; BT3.2; BT3.3; FLJ40011;
Gene ID 11118
mRNA Refseq NM_001197246
Protein Refseq NP_001184175
MIM 613594
UniProt ID P78410

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BTN3A2 Products

Required fields are marked with *

My Review for All BTN3A2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon